Poslednja poruka: 14 sati, 26 minuta pre
  • Ivana: Cao
  • Eric: Hi, Eric here with a quick thought about your website igricezadevojcice#### Owner! I’m on the internet a lot and I look at a lot of business websites. Like yours, many of them have great content. But all too often, they come up short when it comes to engaging and connecting with anyone who visits. I get it – it’s hard. Studies show 7 out of 10 people who land on a site, abandon it in moments without leaving even a trace. You got the eyeball, but nothing else. Here’s a s
  • Eric: To the igricezadevojcice#### Administrator. my name is Eric and I’m betting you’d like your website igricezadevojcice#### to generate more leads. Here’s how: Web Visitors Into Leads is a software widget that’s works on your site, ready to capture any visitor’s Name, Email address and Phone Number. It signals you as soon as they say they’re interested – so that you can talk to that lead while they’re still there at igricezadevojcice####. Web Visitors Into Leads – CLICK H
  • Ivana: Haha
  • Ivana: Šta radiš ovde
  • Ivana: Nemanja imaš li ti ženu devojku
  • Ivana: Teraj se u qrac
  • Ivana: Wtf
  • Ivana: Buraz 1994 sta radis ti ovde pedofičino
  • Nemanja: 1994 Ivana, ti? Vidim, ovde je i dalje kopiranje u modi...
  • Rafaela: I noticed that your igricezadevojcice#### website might be missing out on approximately a thousand visitors daily. Our AI powered traffic system is tailored to increase your site's visibility: #####://ow.ly/BkSO50U3isZ We're offering a free trial that includes 4,000 targeted visitors to show the potential benefits. After the trial, we can supply up to a quarter million targeted visitors per month. This service could greatly increase your website's reach and visitors.
  • Ivana: Poz
  • Nathaniel: Hey, Remember the "good old days" of domain flipping? Endless hours scouring domain marketplaces... Guessing which domains might be valuable... Cold-calling potential buyers and facing rejection after rejection... Yeah, those weren't actually good days at all. But that's how it used to be. Before DomainProphets came along and changed everything. Now, domain flipping is as easy as: Let AI find valuable domains for you: #####://###.nowbusiness#####/domainprophets Get
  • Nemanja: imagine if caseoh said “HAWK TUAH” (ayo sus????) and then jynxi said “Barrr aimm” JAH PULL OFF!!! chills bro... literal chills... might need my DIOR DIOR jacket for this one... kai cenat: E E Ei! squidward: giggle giggle ishowspeed: mews rick ross: if i was rod wave i would surf the world!!! max design pro: sigma edit woaguy: GOONER SQUAD, ACTIVATE!
  • Douglas: I saw that your igricezadevojcice#### website could be missing out on approximately 1K visitors daily. Our AI powered traffic system is tailored to enhance your site's visibility: #####://ow.ly/b6IF50U3its We're offering a free trial that includes four thousand targeted visitors to show the potential benefits. After the trial, we can supply up to 250K targeted visitors per month. This opportunity could greatly increase your website's reach and traffic.
  • Casey: I see that your igricezadevojcice#### website may be missing out on approximately a thousand visitors daily. Our AI powered traffic system is tailored to increase your site's visibility: #####://ow.ly/eFzr50U3iqE We're offering a free trial that includes 4,000 targeted visitors to show the potential benefits. After the trial, we can supply up to 250K targeted visitors per month. This solution could greatly increase your website's reach and visitors.
  • Ivana: Koje si godiste Nemanja?
  • Nemanja: Hvala na pitanju
  • Nemanja: Ja sam odlično Smile
  • Ivana: Nemanjka dobro sam a ti?
  • Marissa: I noticed that your igricezadevojcice#### website might be missing out on approximately a thousand visitors daily. Our AI powered traffic system is tailored to enhance your site's visibility: #####://ow.ly/BkSO50U3isZ We're offering a free trial that includes four thousand targeted visitors to show the potential benefits. After the trial, we can supply up to a quarter million targeted visitors per month. This service could greatly increase your website's reach and engagement.
  • Cone: trazim devojku
  • Cone: _ivanoviccn
  • Cone: Zapratite me na instagramu uzvracam
  • Nemanja: Ko je ovaj Eric?
  • Eric: Hi igricezadevojcice#### Webmaster. My name is Eric and unlike a lot of emails you might get, I wanted to instead provide you with a word of encouragement – Congratulations What for? Part of my job is to check out websites and the work you’ve done with igricezadevojcice#### definitely stands out. It’s clear you took building a website seriously and made a real investment of time and resources into making it top quality. There is, however, a catch… more accurately, a qu
  • Nemanja: Kako si Ivana?
  • William: Struggling to grow your social media? Media Mister delivers real followers, likes, and engagement to help you stand out. Save time, dominate your niche, and turn visibility into revenue. > Click this #### to grow your social presence today! #####://zenlivingstyle####/social-brand-trust
  • Ivana: Nemanja pozzz
  • Nemanja: Pozzz
  • guest_3299: ti sama sa sobom pricas! Mad Mad Mad Mad Mad Mad Mad Mad Mad Mad
  • Ivana: Poz.
  • Irene: Do you need targeted Customers emails and phone numbers , so I am here to help you check out my Fiverr 5 stares profile serving over 880 happy customers contact me here and tell me what you need ===== > #####://tinyurl####/3ckxfu2c See you there Regards Awals
  • Michelle: Hi igricezadevojcice####, Are you ready to take your business to the next level with the power of AI? Imagine having instant access to the world’s leading AI tools, all in one place, and without any monthly fees. Welcome to Total Ai, where the future of business innovation is at your fingertips. Why Total Ai is a Game-Changer: Single Dashboard: Access top-tier AI tools like ChatGPT 4, Gemini Pro, DALL·E 3, and more from a single platform: #####://###.enterprisetoday#####/lead
  • guest_8082: zdravo
  • Ivana: Poz
  • Randi: Good day Reveal the secret to making over $300 every day, getting started right now. Discover how easy it is – anyone can make it happen... Avoid missing this one-time offer. Press here to begin! → #####://zeep.ly/rksLe Sincerely Randi Canada, QC, Quebec, G1e 2l3, 2978 Avenue Royale To stop any further communication from us, please reply to this email...
  • Eric: Dear, Eric here with a quick thought about your website igricezadevojcice#### Admin. I’m on the internet a lot and I look at a lot of business websites. Like yours, many of them have great content. But all too often, they come up short when it comes to engaging and connecting with anyone who visits. I get it – it’s hard. Studies show 7 out of 10 people who land on a site, abandon it in moments without leaving even a trace. You got the eyeball, but nothing else. Here’s a
  • Travis:
  • Ivana: Poz
  • guest_189: Very Happy
  • Eric: Hello igricezadevojcice#### Owner! My name’s Eric and I just came across your website - igricezadevojcice#### - in the search results. Here’s what that means to me… Your SEO’s working. You’re getting eyeballs – mine at least. Your content’s pretty good, wouldn’t change a thing. BUT… Eyeballs don’t pay the bills. CUSTOMERS do. And studies show that 7 out of 10 visitors to a site like igricezadevojcice#### will drop by, take a gander, and then head fo
  • Ivana: Cao
  • Ronny: Social media marketing boosts your business by capturing your target audience with contemporary, stylish content. Let me do for you Modern designs for Instagram, Facebook post design, Twitter, LinkedIn, Pinterest, TikTok, Shopify, and your website with captivating social media post designs. I can help you to Make your Social Media more glowing visit my 5 star profile and join over 3000 happy customer Click here to check out and lets start work together ===== > #####://tinyurl####
  • Betty: Hi there, The photography industry is changing. Be at the forefront with your own AI Photo Studio Business! What you'll receive: • 70 Professional-Quality AI Photos • Multiple Gender & Model Options • Commercial Usage Rights • Unlimited Photo Generation • 3-Month Photo Storage • One-Click Creation Process • Rapid 5-Minute Photoshoots Cater to various client needs: corporate headshots, product photos, social media content, and more. Set competitive prices and keep
  • Ivana: Hej
  • Leonard: Hey Igricezadevojcice, Are you dreaming of financial freedom? I’ve been in your shoes. But now, I’m waking up every day to $1,233 in passive income—effortlessly. How? It’s all thanks to AI Traffic Secrets —a powerful collection of AI tools and training that skyrocketed my business. These tools work seamlessly, automating my traffic, boosting engagement, and driving consistent income. =>> #####://ai-traffic-secrets.############/ The best part? I use these tools every day. Th
  • Eric: Dear igricezadevojcice#### Webmaster! Cool website! My name’s Eric, and I just found your site - igricezadevojcice#### - while surfing the net. You showed up at the top of the search results, so I checked you out. Looks like what you’re doing is pretty cool. But if you don’t mind me asking – after someone like me stumbles across igricezadevojcice####, what usually happens? Is your site generating leads for your business? I’m guessing some, but I also bet you’d like
  • Ivana: Hej
  • guest_496: Very Happy
  • Eric: Hi igricezadevojcice#### Admin. My name’s Eric and I just came across your website - igricezadevojcice#### - in the search results. Here’s what that means to me… Your SEO’s working. You’re getting eyeballs – mine at least. Your content’s pretty good, wouldn’t change a thing. BUT… Eyeballs don’t pay the bills. CUSTOMERS do. And studies show that 7 out of 10 visitors to a site like igricezadevojcice#### will drop by, take a gander, and then head for t
  • Ivana: Poz
  • Daisy: Good day Unlock Your Independence with a Proven Business Discover the freedom of owning a successful business and say goodbye to the corporate grind. With our unique opportunities, you can buy and own a thriving enterprise, gaining financial independence and a lifestyle that truly fulfills you. Start your journey today—click here to explore available businesses! >>> #####://zeep.ly/GEQUL Thanks, Doug Thorpe
  • Eric: Dear igricezadevojcice#### Admin. this is Eric and I ran across igricezadevojcice#### a few minutes ago. Looks great… but now what? By that I mean, when someone like me finds your website – either through Search or just bouncing around – what happens next? Do you get a lot of leads from your site, or at least enough to make you happy? Honestly, most business websites fall a bit short when it comes to generating paying customers. Studies show that 70% of a site’s visitors disapp
  • guest_9307: koliko pedofila ovde mjk mila
  • Eric: To the igricezadevojcice#### Owner. this is Eric and I ran across igricezadevojcice#### a few minutes ago. Looks great… but now what? By that I mean, when someone like me finds your website – either through Search or just bouncing around – what happens next? Do you get a lot of leads from your site, or at least enough to make you happy? Honestly, most business websites fall a bit short when it comes to generating paying customers. Studies show that 70% of a site’s visitors disa
  • Ivana: Hej
  • Dddddddd: Čudne su to stvari svegam
  • Dddddddd: boze mislim da me jedan decko izbegava jer sam ja njega ali nenamerno... mislim da se malo razocarao a dobio je sta je trazio ne razumem
  • guest_7894: Sto se duplira
  • guest_7894: Ne znam šta se dešava sa ovim sajtom
  • guest_7894: Ima pomalo
  • guest_7894: Ima pomalo
  • guest_7894: Ima pomalo
  • Ivana: Ima li kise kod vas?
  • Eric: Hi igricezadevojcice#### Owner! Eric here with a quick thought about your website igricezadevojcice####... I’m on the internet a lot and I look at a lot of business websites. Like yours, many of them have great content. But all too often, they come up short when it comes to engaging and connecting with anyone who visits. I get it – it’s hard. Studies show 7 out of 10 people who land on a site, abandon it in moments without leaving even a trace. You got the eyeball, but nothi
  • Christin: Still looking to get your WordPress website done, fixed, or completed? Reach out to us at e.solus@gmail#### & Prices starts @ $99!
  • Ivana: Svasta a ti?
  • guest_7894: Kaj delaš
  • guest_7894: Ivana
  • Ivana: Pozzz
  • Hairniggabal: I don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklife
  • Hairniggabal: I don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklife
  • Hairniggabal: I don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklife
  • Hairniggabal: I don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklife
  • Hairniggabal: I don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklife
  • Hairniggabal: I don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklife
  • Hairniggabal: I don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklife
  • Hairniggabal: I don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklife
  • Hairniggabal: I don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklife
  • Hairniggabal: I don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklife
  • Hairniggabal: I don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklife
  • Hairniggabal: I don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklife
  • Hairniggabal: I don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklife
  • Hairniggabal: I don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklife
  • Hairniggabal: I don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklife
  • Hairniggabal: I don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklife
  • Hairniggabal: I don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklife
  • Hairniggabal: I don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklife
  • Hairniggabal: I don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklife
  • Hairniggabal: I don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklife
  • Hairniggabal: I don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklife
  • Hairniggabal: I don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklife
  • Hairniggabal: I don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklife
  • Hairniggabal: I don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklife
  • Hairniggabal: I don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklife
  • Hairniggabal: I don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklife
  • Hairniggabal: I don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklife
  • Hairniggabal: I don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklife
  • Hairniggabal: I don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklifeI don't have girlfriend in my life till now. But I see them, but they have boyfriends like you. So I start to see my worklife
Arhiva

Smajliji?
Very HappySmileWinkSadSurprisedShockedConfusedCoolLaughingMadRazzEmbarrassedCrying or Very SadEvil or Very MadTwisted EvilRolling EyesExclamationQuestionIdeaArrowNeutralMr. GreenGeekUber Geek

Sada je 371 gostiju na sajtu

Poslednji komentari

Rasprodaja
Gooj kebooj joo
Priprema jela
ANDJELA ne mlat
Gangnam Style ples
JIMIIINNNNNNNNN
Strumpfeta oblacenje
strumfovi su sr
Poruke posjetioca
skibidi ohio ri
Bratz zaljubljena
FUJ BRBI JE BO
Barbika za Vaskrs
neradi ova igri
Dress up avatar igra
LEPA OVA IGR
Barbi na poslu
jako dobre igri
Priprema jela
Crying or Very Sad :c
Sminkanje Gage
( 7301 glasova )
Igre za djevojčice - Šminkanje

Označi ovaj sajt kao Vaš omiljeni sajt !
 
Komentari (1715)Add Comment
feedRSS link na komentare
‹ First  < 7 8 9 10 11 12 13 14 15 >  Last ›
...
napisao ermina, 26 September 2011
Igrica je cooL
...
napisao ermina, 26 September 2011
DOBRA,PREDOBRA
...
napisao Anđela, 16 September 2011
dobra je!!!!!!!!!!!!!!!!!!!!! SmileSmileSmileSmileSmile
...
napisao Amber, 11 September 2011
Ta kujaaaaa!!!
...
napisao 456, 03 September 2011
bas je s**si ova lejdi gaga ala je treba j**ati uh ja sam teo jednom kad sam je vido uzivo skinuti golu da je s**sam
...
napisao ja !@!@, 01 September 2011
da ima malo vise nekih stvari u delu gde su cipele...ili da ima malo vise frizura!!!
...
napisao RazzPPP, 30 August 2011
Igra je ok... Smile
...
napisao SUZY, 30 August 2011
igrica je ok,nije losa.ali je glupo sto nema malo vise obuce,
U SVAKOM SLUCAJU JE OKKKKKKKKKKKKKKKK.I NEKA JEDU g***a MALO ONI KOJI KAZU DA JE IGRICA GLUPA,MADA U SVAKOM SLUCAJU SVAKO IMA SVOJE MISLJENJE.
...
napisao Marija Bojkovic, 29 August 2011
igra bje oookkk
...
napisao Marija Bojkovic, 29 August 2011
ccxvvgvsvfsvfffvdvdfcfvfdvshgfdhhqwertyyuiop]';lkjhgfsa
azzxcvbnm,./qwertyuiop[]';lkjhgfdsaxxccvbnm,./'/;.l,kmjnhbgvfcdxszaqwetryiuo[p] salim se vigra je ooooooooooooooooooooookkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk
kk
...
napisao mackica, 29 August 2011
nije s****e cool je
...
napisao swatka mala, 29 August 2011
s****e od igre
...
napisao jaaa !@!@, 29 August 2011
nelici na gagu...???
...
napisao Jovana-Joxy-Lukovic, 27 August 2011
s****e od igrice
...
napisao Smile, 22 August 2011
COOL!!!!!!!!!!!!
...
napisao daca mucibabic, 21 August 2011
ja sam mala k**va
...
napisao martinaaaaa, 20 August 2011
najboljaaaaaaaa si ti brate dragi culllll cullova Wink Smile Very Happy 3Smile
...
napisao min$hy, 17 August 2011
extraaaaaaaaaaaaaaaaaaaaaaa
...
napisao marija, 17 August 2011
ehtra je igrica nemam reci
...
napisao luka mladenovic, 13 August 2011
ovA IGRICA JE SUPER Smile
Smile
Smile
...
napisao Kaca, 07 August 2011
Bila jednom jedna devojcica.Poslali su je na ljetovanje jer je imala tetu na moru.Nakon sto je kupila sladoled otišla je plivati.Nakon toga ona se zaklela da ce se osvetiti svakome ko procita ovaj post i ne nalepi ga na 10 komentara.Ako to ne uradis majka ce ti umreti za 4 sata a ona ce ti se u ponedeljak uvece usunjati u sobu i ubijati te svojim nozem.Sad si se uvalio.nije bitno ako nisi procitao sve... :/
...
napisao igor, 07 August 2011
igra je bas glupa
...
napisao medisa, 04 August 2011
ova igrica je glupa
...
napisao ANDREA (LADY GAGA), 29 July 2011
Ova igrica mi je jedna od najboljih od najbolje i najlijepse pjevacice na svijetu LADY GAGE!!!! Smile Smile Razz :O Very Happy
...
napisao plavusica :p, 28 July 2011
volim lady gagu zato sto je plavusa kao jaa! I LOVE LADY GAGA BECAUSE SHE IS BLONDE LIKE MEE! :p
...
napisao r, 28 July 2011
Bila jednom jedna devojcica.Poslali su je na ljetovanje jer je imala tetu na moru.Nakon sto je kupila sladoled otišla je plivati.Nakon toga ona se zaklela da ce se osvetiti svakome ko procita ovaj post i ne nalepi ga na 10 komentara.Ako to ne uradis majka ce ti umreti za 4 sata a ona ce ti se u ponedeljak uvece usunjati u sobu i ubijati te svojim nozem.Sad si se uvalio.nije bitno ako nisi procitao sve
...
napisao ******, 23 July 2011
NIJE LOSE
...
napisao ILIC ALEKSANDRA, 17 July 2011
LEPA,DOBRA...
...
napisao LENA, 10 July 2011
Igrica je predobra Smile
...
napisao sara , 10 July 2011
igrica je bezveze nikad gora
...
napisao *JoJiTaA*, 04 July 2011
*igra je dobrAaA,..swidja mi se!!*
...
napisao milica , 04 July 2011
igrica je supper sto bi se reklo sjajna ekstra i lepa je ona devojka sto se sminka i oblaci
...
napisao iva, 02 July 2011
igrica je super
...
napisao Danica, 27 June 2011
Slusaj ti ovu ,,Volim ovu igricu...Volim i Lady GaGU..A najvise volim svod decka...."koja glupost!!!!!!!!!!!!!! Wink
...
napisao Kaca*, 27 June 2011
Volim ovu igricu...Volim i Lady Gagu...Ali najvise volim...SWOG DECKA SRDjANA
...
napisao ***, 25 June 2011
gagu obozavam najbolja je a igrica je extra...Smile
...
napisao NINA, 23 June 2011
FANTASTICNA JE IGRA... JAKO MI SE SVIDA... OKKKKK
...
napisao NINA, 23 June 2011
IGRA JE PREDOBRA
...
napisao justin bieber, 22 June 2011
odelo je grozno,kao i ova glupava,nafurana,umisljena lady gaga...
fuuuuuuuuujjjjjjj odvratni ste,ma pusite mi k***c ustvari...
...
napisao napisala anja, 22 June 2011
najbolja igrica na citavom svetu
...
napisao .............., 21 June 2011
jedva vidim sta stavljam ali Gaga je ocajna
...
napisao MICHAEL JACKSON, 20 June 2011
NEMOZE NIKAD BIT BOLJA OD MENE STA DA SE RADI KAD SAM BOLJI ZGODNIJI I NARAVNO LEPSI OD TE KRAVE
...
napisao tamara, 18 June 2011
igrica je ok,ali malo je dosadna
...
napisao \la ANDRIJANA, 16 June 2011
MO2DA OVA IGRICA JE SUPERRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR
RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR
RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR
RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR
RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR
RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR
RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR
RRRRRRRRRRRRRRRRRRRRRRRR
...
napisao A*******A, 16 June 2011
OVA IGRICA JE OKAY,MOZDA MALO DOSADNA ALI JE OK.
...
napisao Marko Kraljevic, 16 June 2011
Ova igrica nije bas nesta...!!
...
napisao ema, 10 June 2011
glupa,igrica,,msm,nikada,nisam,videla,da,neko,nosi,glup
lju,odecu,nakit,obucu...
...
napisao Anita Mikleus, 10 June 2011
Igrica je lepa a, i obozavam Lejdi Gagu;'''




















...
napisao bjanka i ivona, 10 June 2011
bjanka kaze grozna igrica, a ivona kaze isto mislim fuuuuuuuuuuuuuuuuuuuuujjjjjjjjjjjjjjjjjjjjjjjjjj!!!!!!!
!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!
...
napisao napisala silvija, 07 June 2011
tomice ajde da zezad tevidu kazi joj crni i mefailj a fati kazi bango
...
napisao napisala silvija, 07 June 2011
extra igrica samo treba neke druge cvikere i neke druge sandale a one velike su fujjjjjj mislim lepe ali one pertle za patike one crne sto su tamo kod te cipele fujjjjjjj katastrofa salim se bre extra je igrica
...
napisao emchy, 01 June 2011
Igrica je pre pre glupa!
...
napisao 000p0000, 01 June 2011
glupa je igra hahahahha
...
napisao PAZI DA TI KAZEM, 29 May 2011
PA OVO NECE NI DA SE UCITA KAKO GLUPA IGRICA
...
napisao masa, 29 May 2011
LEDY GAGA JE NAJBOLJA!!!
...
napisao masa, 29 May 2011
IGRICA JE EKSTRA ZA EKSTRA!!!
...
napisao djasmin, 28 May 2011
ekstra je igrica
...
napisao Tandrčak (:, 21 May 2011
Ja glupe igrice moja jadna majko,oo Bo're ti nedaj!! Oo ma brisite ovo da se narod ne prepadne,ooo..3Smile
...
napisao daka, 20 May 2011
hhhhhhhhhhhhhhhhhhhhhhhhhaaaaaaaaaaaaaaaaaaaaaeeeeeeeee
eeeeeeeeeeeeeeeeeeduroh
...
napisao TEEA, 20 May 2011
s
su
sup
supe
super
supe
sup
su
s...............Smile
...
napisao radmila m., 18 May 2011
hahahahhah--ma beži bezze, bolje da izmisle igru u kojoj bi sminkali mene, msm moje lepo lice....hhah...mesaj mala...
...
napisao ...., 18 May 2011
onakoO..SmileSmileSmileSmile
...
napisao natasa, 17 May 2011
jao ovo je super
...
napisao nata, 17 May 2011
igrica je OK ...mozda malo smara ...ali je ok
...
napisao ..., 16 May 2011
Pa onako, je igrica.:-******..aa Lady Gagu obozavam..Pogotovo njen ludi stil oblacenja,a i njene pjesme narawnoo..Smile))....
...
napisao gumus, 16 May 2011
ovo je najbolje
...
napisao napisala milica, 14 May 2011
igrice je dobra
...
napisao fds, 14 May 2011
i love lady gaga!!!!!!!!!!!
...
napisao Sarchy ^^, 12 May 2011
Lady Gagu obozhawam ....
...
napisao martina radovic priboj, 11 May 2011
predlazem da slusate pesmu combe cvele tatula mala igra je coooooool ma tako
...
napisao Lady Gaga Daki, 09 May 2011
l am beautiful and l am cute wow!- Ja sam prelepa i ja sam slatka! haha sala mala. Smile Smile
...
napisao joka , 09 May 2011
coollllllllll!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!
...
napisao milica, 27 April 2011
igrica je kkkkkkkkkkkkkkkkkkkkkkkkkkkuuuuuuuuuuuuuuuuuuuuuuuuuuuu
uuuuuuuuuuuuuuuuuuuuullllllllllllllllllllllllllllllllll
lll
...
napisao teodora, 26 April 2011
igrica super najj
...
napisao ljijla, 26 April 2011
bolje ubacite neku bolju igricu igrica je smor a u opste nije lepa gaga
...
napisao JaaaAA, 25 April 2011
Igrica je basx EXTRA....KO ME SE NE SWIDJA NE MORA DA JE IGRAAAA
...
napisao ANDREA, 21 April 2011
OOOOOOOMMMMMA
...
napisao gordana 19.04.2011, 19 April 2011
igrica je ccccccccccccccccccccccccccccccccccccccccccccccccccccccc
cccccccccccccccccccccccccccccccccccccccccccoooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooool
lllllllllllllllllllllllllllllllllllllllllllllllllllllll
lllllllllllllllllllllllllllllllllllllllllllllllllllllll
llllllllllllllllllllllll
...
napisao vanjaaaaaa, 19 April 2011
igrica je onako
...
napisao Andrea Milenovic, 16 April 2011
Igrica je vrh ali Lejdi Gaga na njoj nije kul....... Razz
...
napisao BOJANA VLAHOVIC, 15 April 2011
Smile)))))))))))
...
napisao Gaga, 15 April 2011
igrica je ok ............
...
napisao Yeca, 15 April 2011
Igrica je totalni smor....A i GaGa je ovde bas ruzna....Sad((((
...
napisao maka, 12 April 2011
mo jedi k***c
...
napisao maka, 12 April 2011
bas je groyno
...
napisao maka, 12 April 2011
svidja mi se mnogo a vi da jedete g***a
...
napisao ladu gaga, 11 April 2011
SAMO VISE I VISE KOMENTARA !!!!!!!!!



CAO Wink)))))))))))) !!!!!!!!
...
napisao ladu gaga, 11 April 2011
VOLIM VAS ******************* LADU GAGA*************MOZE LI*********
...
napisao ladu gaga, 11 April 2011
SAMO NAJJJJJ NEKA BUDU OK .....
HVALA VAM !!!!!! SVIMA DOBRIMA @@@@@!!!!!!!!
...
napisao ladu gaga, 11 April 2011
AJDE IJUDI DA VIDIM KOMENTARE !!!!!!!!!
...
napisao ladu gaga, 11 April 2011
HVALA TI MILIJANA!!!!!!!!!





















































































*******************HVALA PUNO *********************
...
napisao ladu gaga, 11 April 2011
MA MALO VISE MOZE DA IMA KOMENTARA NAPISITE SVI PO 4,5 MOZE LI ??????? HVALA VAM !!!!!!
...
napisao ladu gaga, 11 April 2011
LEPO LEPO LEPO MOZE MOZE BOZE !!!!!!!
...
napisao ladu gaga, 11 April 2011
NECE TI NIKO OG !!!!!!! @@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@
@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ MOZDA I HOCE NEKO GLUP!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!
!!!!!
...
napisao ladu gaga, 11 April 2011
hvala onima koima je igra lepa a onima kojima nije neka je ne igraju i neka ne jedu ono sto se ne***










HVLA ONIMA KOJI MENE VOLE>>>>>>>>>>333333333
...
napisao ladu gaga, 11 April 2011
slazem se sa ajlom i nekima cool je bas ko i ja na njoj
...
napisao ladu gaga, 11 April 2011
pa sta reci extra sam nek napise ja ko se slaze !!!!!!! voli vas ladu gaga @@@@@@@@@@@@@ pozz
...
napisao ivki, 10 April 2011
igrica je totalno u fazonu,sta vi tu kenjate . .
...
napisao sandra,10.2011, 10 April 2011
ekstra je igrica
...
napisao ajla, 09 April 2011
igrica je bas cool sta vi ser*** da je glupa
...
napisao NAPISALA aleksandra, 08 April 2011
igrica mi se ne svidja glupa je
...
napisao neucu ti kazem, 07 April 2011
prezirem tu **** **** nesmem ni ime da joj napisem
...
napisao neucu ti kazem, 07 April 2011
koliko su je svukli oce golu da skinu
...
napisao znam bolje, 03 April 2011
SUPER JE IGRICA EXTRA I NE TREBAM DA CEKAM 3 SATA DA POCNE STVARNO JE STRAVA
...
napisao antonija, 03 April 2011
ova igrica je super,cool i obožavam je ,kao i gagu.
...
napisao lady gaga, 03 April 2011
thanks what"s
...
napisao gaga, 02 April 2011
igra je exstraSmile
...
napisao tamara, 01 April 2011
ova igrica je super ali ponekad je malo dosadna obozavam te gago
...
napisao s*xSANDRA, 30 March 2011
VEOMA s*xSI
...
napisao iva, 30 March 2011
bas je cooool ova igra fatasticna je
...
napisao tina, 26 March 2011
lepa igra
...
napisao anastasija ana andjic , 22 March 2011
ova igrica jjjjjjjjjjjjjjjjeeeeeeeeeeeee sssssssrrrrrrrrrrraaaaaaaaaaaaaaannjjjjjjjjjjjjjjjjjjjj
jjjeeeeeeeeeeeeeeeeeeeee znaci debilazna
...
napisao milica99, 22 March 2011
igrica je super stalno je igram
...
napisao kadira, 18 March 2011
lepa je ova igrica veoma lepa a i druge su lepe svi su leope igrice kadira love kisssssssssssss
...
napisao andrijana, 15 March 2011
igrica nije losa moze i bolje :*
...
napisao **********************..., 13 March 2011
igrica je extra.samo kad bi se zezali . glupost najjjj... ?
...
napisao simona, 13 March 2011
a ne no bidon!
...
napisao kristina, 13 March 2011
owa igrica je ekstra!!!Smile :*
...
napisao tanja, 13 March 2011
i love you lady gaga!!!:*
...
napisao anita, 12 March 2011
meni se svidja
...
napisao BOJANA VLAHOVIC, 08 March 2011
igra je coooooooooool aliSmile
...
napisao Jana Antic, 07 March 2011
*igrica nije losa XDD
...
napisao Ana , 07 March 2011
Igrica moze da prodje
...
napisao _________________________, 07 March 2011
IGRICA je eXtraaaaaa
...
napisao ___________, 07 March 2011
IGRICA JE PRALEPAAAA
...
napisao Marija 93, 06 March 2011
jedna od najboljih igrica sa lady gagom.Smile)))
...
napisao jovana, 04 March 2011
igrica je extra :*
...
napisao sofi, 04 March 2011
igrica je dobra
...
napisao ana ivkovic 5/2 99, 01 March 2011
kul igrica
...
napisao NIKO, 28 February 2011
Wink Smile :*
...
napisao mina, 27 February 2011
igrica je mnogo glupa
...
napisao zeljana pekic, 26 February 2011
zivo SARNJE
...
napisao Ana...... Ana.....????, 25 February 2011
........Marija.....Tamara......Marija......
...
napisao BOJANA VLAHOVIC, 24 February 2011
igrica je jako dobra strava ...mislim

coooooooooooooooooollllllllllllll
...
napisao joja, 24 February 2011
igica je cista glupostav daj bre
...
napisao sandra markovic, 23 February 2011
ekstra igra...sve...najj...najj???????????????????SmileSmileSmile
...
napisao Jowanica, 20 February 2011
Eeeeej jel ima neko za dop?ja sam jowanica mislim da sam bas lepa,ustvari sigurna sam imam dugu plavu kosu zelene oci i dobre sise!!!ooops!
...
napisao Jowanica, 20 February 2011
JoooooooooJ LJUDI IGRICA JE SUPER ALI MALO SAM SE SMORILA!!!JEL NEKO ZA BLEJU?LJUBI VAS JOVANICA :*
...
napisao JJJJJJJJAAAAAAAAA========, 20 February 2011
IGRICA JE CISTA GGGGGGGGGGGGLLLLLLLLLLUUUUUUUUUUPPPPPPPPOOOOOSSSSTTT!!!
!!!!!!
...
napisao Andjela, 20 February 2011
GROZNO!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!
...
napisao hashahah, 19 February 2011
ova igrica sa lejdi gagom je s****e !!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!! i bzvz
...
napisao tamara vucicevic, 19 February 2011
'nikad gluplju igricu nisam igrala'
...
napisao 12345678+9, 17 February 2011
igrica je extra!!!!!!!!!!!!!1111
...
napisao KATARINA KATTY FILIPOVIC, 15 February 2011
NNNNNNNNNNNNNNNAAAAAAAAAAAAAAAAAAAAAAAJJJJJJJJJJJJJJJJJ
JJJJJJJJJJBBBBBBBBBBBBBBBBBBBBBBBBBBBOOOOOOOOOOOOOOOOOO
OOLLLLLLJJJJJJJJJJJJJJJJJJAAAAAAAAAA IGRICA NA SVETUUUUUUUUUUU
...
napisao Miladija, 14 February 2011
Kakoj se bre ovaj igoca igra?Pa ovoj je mlog zaj**ano!!!uuu nek ide u p***a materina,pre cu da igramone za odasle nego ovoj lepotinju!!!!
...
napisao Walentina, 13 February 2011


Igrica je lepa.....dali ima neka devojcica de se dop?

...
napisao jana, 12 February 2011
g***ooo usrano j**em mu mater u pi**ku dlakavu fujj
...
napisao hjeshgoasjgoaeji to,ic ej, 11 February 2011
al joj je frizura extra al u dupetu s****eeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeee
eeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeee
eeeeeeeee,samo se retardima ovo svidja
smorrrrrrrrrrrrr
...
napisao jasna, 10 February 2011
dosadna je
...
napisao KATARINA KATTY FILIPOVIC, 09 February 2011
SVI KOJI KAZU DA JE OVA IGRICA LEPA UPRAVU SU
...
napisao andjelina, 09 February 2011
i da da ovo nije ledy gaga i ne lici na nju
...
napisao andjelina, 09 February 2011
ledy gaga mi je grozna i ne slusam njenu muziku vec nightwish,metalicu,riblju corbu. . . . .. ali ova igrica nije losa
...
napisao jhhg, 07 February 2011
6zzzzzzzzzzzzzzzzzzzzzzzzzzzzzzgz
...
napisao enisa, 07 February 2011
vau ovo je kul
...
napisao lejdi gaga s****e..-.-', 04 February 2011
igrica je goovnoo..a lejdi gaga je s****e!!!:/
...
napisao fadila, 02 February 2011
obožavam te Gago nova igrica extra je
...
napisao EMILIJA I MARIJA, 01 February 2011
IGRICA JE s****eEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEE!!!!!!!!!!!!!!
...
napisao Miley Finely - Cyrus, 30 January 2011
Thast Cool Lady Gaga I Love You.. Thtas Sweet... Do you want to go Shoping?
...
napisao milica, 28 January 2011
obozavam lejdi gagu super je igrica
...
napisao nemam ime, 25 January 2011
wow super
...
napisao g***o, 25 January 2011
superrrrrrrrrrrrrrr
...
napisao delila , 25 January 2011
super igrica
...
napisao natasa , 24 January 2011
pa i nije tako zabavna ova igrica sa ,,gagom,,.........ja volim (obozavam) lady gagu ali ovo joj nije ni primaci... Smile) c(:
...
napisao ivana, 23 January 2011
gluposttttttttt liiiiiiiii
...
napisao jovana, 23 January 2011
ova NOBA igra je super za devojciceeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeee
eeeeeeee.....
...
napisao tijana, 23 January 2011
ova igrica je super
...
napisao semipreciousweapons, 21 January 2011
fora igra.. al treba bolja obleka... gaga ovo nikad ne bi nosila!
...
napisao anaa, 20 January 2011
j**em vam mater ovo je g***o a ne ladi gaga k***c pusi k***c dlakav neobrijan hejj jja sam jela slaninu i ladi gagu upitalaa oces ti malo?:: da ga pusi i lizi gaga
...
napisao Jovana xD..., 19 January 2011
Igrica je extraa ova mi je prva znaci extraaaaaaaaaaaaaaaaaaaaaaa
...
napisao Jovana, 19 January 2011
Neznammm nije lepa uopste ne lici na lady gagu
lepsa je negde drugde.
I neznam menii je FUJJJ
...
napisao napisla Ana, 19.1.2011., 19 January 2011
Jeste da Gagy mrzim, ali ova igra jeeeeeeeeeeee supeeeerrrrrrrrrrrrrrrr !!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!! 8)
...
napisao ema*.333, 19 January 2011
glupa igra
...
napisao masa, 19 January 2011
IGRICA JE EEEEEEEEEEEEEEEEEEEEEEEEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHH
TTTTTTTTTTTTTTTTTTTTTTRRRRRRRRRRRRRRRRRRRRRRRRRRRRAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
...
napisao napisala tvoja najveća o, 19 January 2011
igra je o.k ali ti si gaga 100000000000000000000000000000 puta bolja
...
napisao marija, 18 January 2011
hahahahahahahahahahahahahahahahahahahahahahhahahahahaha
hahahahaahahhaahah
...
napisao zeljkapopovic, 16 January 2011
igrica je sssssssssssssssssssssssssuuuuuuuuuuuuuuuuuuuppppppppppp
pppppppeeeeeeeeeeeeeerrrrrrrrrrrrrrrrrrrr pozdrav svima pozzzzzzzzzzz....cao igrica je extra
...
napisao franjka križanac , 14 January 2011
ssssssssssssssssssssssssssssssssssssssssssssssssssssssu
uuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuppppppppp
ppppppppppppppppppppppppppppppppppppeeeeeeeeeeeeeeeeeee
eeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeerrrr
rrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrr
rrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrr
rrrrrrrrrrrrrjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjj
jjjeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeee
...
napisao ivana beljan, 14 January 2011
OVA IGRICA NICEMU NEVALJA ALI JE IGRAM IZ DOSADE HA HA HA HA HA HA :p
...
napisao katarina ilic, 13 January 2011
JJJJJJJJJUUUUUUUUUUPPPPIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIII
...
napisao ana, 13 January 2011
igrica je super gaga je bas lepa !!!!
...
napisao BLANKA ČIRJAK, 13 January 2011
COOL IGRA NAJBOLJA IGRA ŠMINJKANJA NA SVITU
...
napisao Lady GaGa fan.. Smile, 13 January 2011
GaGa ma kolko igra bila glupa, wolecemo te mi, Your little monsters.. Go GaGa!!
...
napisao bojana i iva, 11 January 2011
igrica je jako gglluuppaa!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!Smile
...
napisao bojana i iva , 11 January 2011
igrica je estraSmile
Wink:*
...
napisao nikolina, 11 January 2011
sssssssssssssssssssssssssssssssssssssssssssssssssssssss
ssssuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuu
uuuuuuuuuuupppppppppppppppppppppppppppppppppppppppppppp
pppppppppppppeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeee
eeeeeeeeeeeeeeeeeerrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrr
rrrrrrrrrrrrrr
...
napisao sarita minic sara, 07 January 2011
igrica je super
...
napisao ZALJUBLJENA MALA, 07 January 2011
SUPER IGRA,LADY GAGA JE MOJ NAJVECI FANNNNN.
...
napisao LEPOTICA, 07 January 2011
E TI SFSDH NE PISE SE GAGO OBOZAVAM TE VEC GAGA OBOZAVAM TE.
...
napisao najlepsa na svetu, 07 January 2011
E TI BOXY NEMORAS NAS UCITI KAKO SE PISE STA SI TI TO SAD NAPISO,I TI SI SAD NEKI JUNAK SVI ZNAMO DA SE PISE LADY GAGA,AL NEKO POGRESI PA STA.
...
napisao lady gaga, 07 January 2011
samo malo ona možda je i tvoj idol ali meni se više sviđa ima sve što je bilo u prodaji od nje pa čak i njezin autogram bila sam na njenom koncertu upoznala sam je u berlinu
...
napisao lady gaga, 06 January 2011
so happy
...
napisao kornelija, 05 January 2011
lady gaga je jedan od mojih omiljenih fanova i volim je najvise na svetu!drugi ne ka kazu za nju sta hoce ali ona nije musko!!!!!sve u svemu igrica je exxtraaa!
...
napisao ho cares♥♥♥, 05 January 2011
this is the styped game i every see♥
...
napisao Jovana Valic, 05 January 2011
Nije losa svidja mi se....................................
...
napisao ♥!, 04 January 2011
Dobra je...
...
napisao diana i ivana , 04 January 2011
igra smara
...
napisao Brendha Cook, 03 January 2011
yes i don't speak Serbian!! Smile
...
napisao Brendha Cook, 03 January 2011
Game is little guess!!right!!
...
napisao sara , 03 January 2011
igrica je cool obozavam je
...
napisao sara , 03 January 2011
igrica je cool
...
napisao alexandra ilic, 03 January 2011
ajde vi k**ve necete vise igrati vise igrice za devojcice
j**ite se i dodjite kod mene i j**ite me
...
napisao alexandra ilic, 03 January 2011
igra je s**si
...
napisao sara minovic VIII5, 02 January 2011
srecna nova 2011 za sve iako je kasno a sto se tice igre super nego mi se nesvidja to sto je onaj po imenu ********* napisao da je dosadna
...
napisao Sara maric, 02 January 2011
Ja sam sara i recicu vam da mi se svidja i super je ali onaj koji se zove kao sto pise ime mu je ********* kaze da je dosadna a nije uopste da zna ako ovo cita!Sad
...
napisao kristina, 02 January 2011
sssssssssssssssssssssssssssssssssssssssssssssssssssssss
ssssssssssssssssuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuu
uuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuppppppppppppppppppppppp
ppppppppppppppppppppppppppppppppppppppppppppppppeeeeeee
eeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeee
eeeeeeeeerrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrr
rrrrrrrrrrrrrrrrrrrrrrrrr
igrica
...
napisao ivana, 02 January 2011
IGRICA JE ODVRATNAA!!!!!!!!! Smile
...
napisao kristina, 02 January 2011
sssssssssssssssssssssssssssssssssssssssssssssssssssssss
ssssssssssssssssuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuu
uuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuppppppppppppppppppppppp
ppppppppppppppppppppppppppppppppppppppppppppppppeeeeeee
eeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeee
eeeeeeeeerrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrr
rrrrrrrrrrrrrrrrrrrrrrrr........xaxaxaxaxaxaxaxaxaxa.......
...
napisao boxy, 01 January 2011
pise se Lady Gaga
...
napisao jovana, 01 January 2011
ovu igricunajvise volim zato sto je najbolja od svih igrica strava je igrica!!!!!!!!!!
...
napisao baba sera, 31 December 2010
lazem bas vam je mocna igrica

vasa baba sera
...
napisao Dunja, 31 December 2010
igrica je extra ali se dugo učitava
...
napisao teica, 29 December 2010
ova je igrica EXTRA.....xd
...
napisao Dajana , 29 December 2010
Lady gaga je najbooooooolja...tko je ne voli ili mrzi on je glup i tko to kaze
...
napisao Dragana, 29 December 2010
Andrej kako se prezivaš
...
napisao Andrej, 29 December 2010
onako
mmnjjugvf
...
napisao **************, 29 December 2010
LADY GAGA je SUPER !!!!!!!!!
ja je obozavam.
...
napisao Jovana, 28 December 2010
Lady Gaga je odvratna!!!!!!Nzm ko nju moze da voli, prosto mi se gadi!
...
napisao jelena 99, 27 December 2010
wow! ja obozavam lady gagu extra je!!!!!!!!!!!!!!!kisssssss za lady gagu
...
napisao ..., 26 December 2010
ti mrzis lady gagu ja mrzim tebe bez stila !!! Razz
...
napisao dosadno mi je............, 22 December 2010
igrica je ekstra i ako mrzim ledy gagu
‹ First  < 7 8 9 10 11 12 13 14 15 >  Last ›

Napišite komentar
Vaš komentar možete napisati ovde

busy